- Recombinant Helicobacter pylori UPF0114 protein HP_0189 (HP_0189)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1074943
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 19,828 Da
- E Coli or Yeast
- 1-177
- UPF0114 protein HP_0189 (HP_0189)
Sequence
MLEKLIERVLFATRWLLAPLCIAMSLVLVVLGYVFMKELWHMLSHLNTISETDLVLSALGLVDLLFMAGLVLMVLLASYESFVSKLDKVDASEITWLKHTDFNALKLKVSLSIVAISAIFLLKRYMSLEDVLSSIPKDTPLSHNPIFWQVVIHLVFVCSALLAAVTNNIAFSQNKAH